Russian space corporation to create 'new spacecraft of the future'

W1siziisijiwmtyvmdkvmduvmjevntavmjivztk3ntizodktztcxyy00mtvjlwexmzetnge3n2y4ytuzzdqyl3nwywnlig9iai5qcgcixsxbinailcj0ahvtyiisijm1mhgynzajil1d?sha=e86986ddf2202451 W1siziisijiwmtyvmdcvmjcvmtkvndgvmzmvmmu1zdrlnjktzwu1ns00ndjllwi5zjgtytizzjgyzdk3zgnjl2lwag9uzs5qcgcixsxbinailcj0ahvtyiisijm1mhgynzajil1d?sha=cd5bc57fe1da2137 W1siziisijiwmtyvmdevmduvmtivndqvmjkvmwi3m2izmjmtowzhzs00n2rilwi3y2etymfkmwm0zji3ndk2l2f6zxjzcgfjzs0yx2ludgvsc2f0xzm4x3jlbmrlcmluzy5qcgcixsxbinailcj0ahvtyiisijm1mhgynzajil1d?sha=c6abe0cb1e07b7e2 W1siziisijiwmtuvmtivmtkvmdkvmjavntgvntq0zta1mzktmzbhos00m2zklthiyjutyzhlnzaymdiwywexl21py3jvc29mdc1zb2z0d2fyzs0xmdi0edy2ms5qcgcixsxbinailcj0ahvtyiisijm1mhgynzajil1d?sha=59d524a6268b12fa W1siziisijiwmtuvmtivmtyvmtavndqvndkvzjjlodi1mmityzg1nc00yze0lthmy2itztvkogu5yzq3ntk1l3zhaglkx21lbhvtyxrfymfua2lfmzawlmpwzyjdlfsiccisinrodw1iiiwimzuwedi3mcmixv0?sha=94b96e338f195375

More from Tech

Azerbaijan attends international ICT exhibition-conference in Minsk

23.04.2013 15:45 GMT

W1siziisijiwmtuvmtavmtkvmtgvmdcvmjgvmdzlymuxmwytm2e0yy00yjhmlwfizjetngnimgi4otllztnhlzexntq2ny5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=658c1d0090942bce
Azerbaijani delegation attends the 20th International Specialized Forum on Telecommunications, Information and Bank Technologies “TIBO-2013” in Minsk, Belarus.

Azerbaijani delegation attends “Caspian Telecoms 2013” international conference

22.04.2013 08:22 GMT

W1siziisijiwmtuvmtavmtkvmtgvmdqvmzkvzja4ngi5njktyjbizi00ymvjlwewmtutnjczntfmoduzntnllzexntmymi5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=fe5fee140aa5d172
Delegations from Turkey, Georgia, Ukraine, Russia, Kazakhstan, Uzbekistan, Tajikistan, Moldova, Mongolia and Kyrgyzstan attended the event.

ICT Ministry working out program for e-government development for 2013-2015

17.04.2013 13:24 GMT

W1siziisijiwmtuvmtavmtkvmtgvmdevmzgvnwmxnjhiyzgtmty0ns00odmzlwfmzjctmdzkyjy2zdrjogu2lzexnte1os5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=1bf7a561ab2bd2b6
The Ministry of Communication and Information Technologies is finalizing the development of the draft State Program for development of e-government and expansion of e-services at the state bodies for 2013-2015.

Average speed of incoming traffic tops 4MB/s in Azerbaijan

15.04.2013 10:42 GMT

W1siziisijiwmtuvmtavmtkvmtcvntkvmtevndywmmiwngmtyta2ny00oty5lwewyjktmjcwnmyxndc0otdklzexntazos5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=c87638553cccd282
The average speed of the incoming internet traffic in Azerbaijan makes 4.02 MB/s.

Azerbaijan, Austria discuss cooperation in ICT sector

10.04.2013 08:15 GMT

W1siziisijiwmtuvmtavmtkvmtcvntuvmzuvmti4yzdhzdqtmgvhmc00mwjkltkxy2itzdczmtiwmzk2owq5lzexndgzmc5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=a03473f756840ca9
Azerbaijani Deputy Minister Elmir Valizade praised the relations between the two countries in the ICT sector.

ICT sector`s revenues to grow to $8-8.5 billion in Azerbaijan by 2020

09.04.2013 08:36 GMT

W1siziisijiwmtuvmtavmtkvmtcvntqvndevnduyntfiyjatymixzi00ytk5ltg1zdktyweyywm0zmu1ywq2lzexndc4my5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=6910fba336f63103
The ICT sector`s revenues currently stand at nearly $2 billion.

Over 1.5m domain names registered in .az domain zone

06.04.2013 09:59 GMT

W1siziisijiwmtuvmtavmtkvmtcvntmvmtuvm2zimgq1mdytodjhny00othilwflztgtztfhmtqynzvmmgqxlzexndcxms5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=533f26931a167053
Number of domains registered in the national top-level domain zone of Azerbaijan .az continues to increase.

Azerspace-1 given to Azerbaijan’s management

03.04.2013 16:34 GMT

W1siziisijiwmtuvmtavmtkvmtcvntevndcvndrmnzjlnjatmgiyoc00owuzlwjjmwityjm1nwnjyzm1ndg2lzexndywny5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=879e5f5c0acbbcba
Azerspace-1 has been finally transferred to Azercosmos OJSC.

Azerbaijan`s ICT sector to grow 4-4.5 times in next 10 years - ICT Minister

01.04.2013 09:00 GMT

W1siziisijiwmtuvmtavmtkvmtcvndgvmtqvzta3zmqzztetnwqzzc00mdjkltgzzjetmddkzje4mtzlyzjjlzexndq1ny5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=86d50239068914cd
“Azerbaijan`s ICT market will grow 4-4.5 times in the next 10 years,” Azerbaijani Minister of Communications and Information Technologies Ali Abbasov said in an interview for Rossiyskaya Gazeta.

Plan of Actions on Year of ICT - 2013 in Azerbaijan endorsed

30.03.2013 09:52 GMT

W1siziisijiwmtuvmtavmtkvmtcvndcvmzavzdeyyjm4ztitzwu1mi00zdq1lthhnzktnjg1ntk2mdixngjilzexndqxos5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=21fb31d84c310575
President of Azerbaijan Ilham Aliyev endorsed the Plan of Actions on the “Year of Information-Communication Technologies - 2013 in the Republic of Azerbaijan”.

TASIM to allow Azerbaijan to become key hub in Caspian region

29.03.2013 12:06 GMT

W1siziisijiwmtuvmtavmtkvmtcvndcvmdyvm2i2ymiwm2uty2q1mc00otg1lwe3zdgtmjc0ngy2zwm3yjm3lzexndm4oc5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=5db9471da9d28dbb
Due to the consistent policy of the government, Azerbaijan has achieved considerable success in the development of telecommunications, broadcasting, Internet infrastructure and information and communication technologies, in general.

IMEI –codes registration system to be applied in Azerbaijan

15.03.2013 14:59 GMT

W1siziisijiwmtuvmtavmtkvmtcvndavntmvy2rjzdbjntkty2mzms00nwi1lwi0ywetzjczogvmmdy3odu1lzexndayms5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=9796f3ce4bb1071b
The IMEI-mobile codes registration system will be applied in Azerbaijan from 1 May.

Korea may build optical fibre plant in Azerbaijan

14.03.2013 12:45 GMT

W1siziisijiwmtuvmtavmtkvmtcvmzkvndqvyzk2ndu4mdytyjvmni00ndkzlwjinjytzme3ywywzwzmmdu0lzexmzk0os5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=dcb0a19ad6b6b3e3
The ICT Ministry of Azerbaijan has held a meeting with representatives of South Korean company LS Cable & System.

Mobile subscribers in Azerbaijan up seven times

09.03.2013 12:06 GMT

W1siziisijiwmtuvmtavmtkvmtcvmzuvmzuvntuzotbjm2qtota3zc00ytm2lwfjzmqtzjyzndczm2u0nzq2lzexmzy5mi5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=e238513a5223719e
In 2012, the number of mobile subscribers in Azerbaijan increased seven times against 2004 and exceeded 10.1m.

Days of Innovations Microsoft-Azerbaijan held in Baku

06.03.2013 11:31 GMT

W1siziisijiwmtuvmtavmtkvmtcvmzivnduvnmiyyzrhyzatywjlos00mzk1lwiwmgytotewmzljy2nhyzi0lzexmzuznc5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=7d4794db6b4a01e0
The Day of Innovations of Microsoft-Azerbaijan is held in Baku on 6 March.

Azerpoct to offer credit service by 2015

05.03.2013 15:43 GMT

W1siziisijiwmtuvmtavmtkvmtcvmzevmdivote4ogmyyjitmdg5zc00ztqzlwe0nwitngqwyzawy2qxzjjjlzexmzq3ns5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=21dbca34a6acec0b
Azerbaijan's state postal operator Azerpoct will be able to offer credit service by 2015.

Digital broadcasting to promote broadband mobile communication

05.03.2013 11:44 GMT

W1siziisijiwmtuvmtavmtkvmtcvmzavntavymu0mgi2nwqtntyxzi00ody1ltk2nzgtoge0mgjlnziwzta1lzexmzq2ms5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=aff769ede280c9a7
The completion of the process of transition to digital broadcasting and organization of high-quality transmission of television and radio programs is one of the priority issues.

Over 17,000 domains registered at '.az' zone

02.03.2013 12:44 GMT

W1siziisijiwmtuvmtavmtkvmtcvmjkvmtqvndq3nwnlzdetnmewys00nmuwlwe5yzutzty3owm3yzu1zdzjlzexmzm1ns5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=9561fb8c7325c648
As many as 17,705 domains were registered in the national zone.

Necessary conditions created for freedom of internet in Azerbaijan – Ali Abbasov

01.03.2013 13:30 GMT

W1siziisijiwmtuvmtavmtkvmtcvmjcvmzavzjg3mthmmgetn2ezmc00mdbklthhntetotdjnzy2mti4y2jhlzexmzi4mi5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=61ab81807e5723e6
Within the framework of the working legislation , the citizens of Azerbaijan can express their opinion both in media and online.

Azerbaijan to enter international markets - communication minister

27.02.2013 11:19 GMT

W1siziisijiwmtuvmtavmtkvmtcvmjqvmjcvotbhntewmwytztm1ni00yte0lthmzjmtyju4mtuznzg2mgqxlzexmzewnc5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=cd46d2e15810a972
Asian region is attractive for Azerbaijan, since it has the countries with developed high technologies and Asian region has a great potential.

Azerbaijan's first telecommunication satellite takes its orbital position

19.02.2013 11:18 GMT

W1siziisijiwmtuvmtavmtkvmtcvmtqvmtuvowizogm3ztetmtmwni00ndbkltgxnjmtmmm2odvkn2zhndi5lzexmju5nc5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=5032003443da5368
Azerbaijan's first telecommunications satellite Azerspace-1 reached the orbital position - 46 degrees East.

Stamps on Azerbaijan's carpets issued in Czech Republic

19.02.2013 09:25 GMT

W1siziisijiwmtuvmtavmtkvmtcvmtqvmduvmwzlmzqxzwutotc1mi00zjhilwfin2qtnzqynzfimwi2nti3lzexmju4mi5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=de15d45d644418b0
Stamps marking Azerbaijan`s carpets have been issued in Czech Republic.

Azerbaijan has specialists and technology to prevent cyber crime – Ministry

18.02.2013 11:44 GMT

W1siziisijiwmtuvmtavmtkvmtcvmtmvmzyvm2uymgmyytqtmtrmmi00zwyzlwjlmtktnge0zwrmmjqxzgjjlzexmju0os5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=118c45d2f869057e
After ratification of the Council of Europe's Convention on Cybercrime by Azerbaijan in 2009, our country has done a lot of work in this regard.

Information and communication services up 13%

16.02.2013 11:25 GMT

W1siziisijiwmtuvmtavmtkvmtcvmtmvmdmvndliyty1mdmtywm2nc00yzljltk0ytetndjizmywywzimjzllzexmjuxms5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=05a2427bd8cbd611
In January, information and communication enterprises offered services to population, offices and organizations in the amount of AZN 111,3m.

Azerbaijani embassy to Poland comments on Armenian hackers’ attack

15.02.2013 18:38 GMT

W1siziisijiwmtuvmtavmtkvmtcvmtivndivntg1ndi4ntatmzqzms00oti2ltg1nwmtyju3zmy1mzgyzju0lzexmjq4ni5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=d83d1a7385b518e8
Armenians hacked the website of the embassy of Azerbaijan in Poland on 15 February.

Azerbaijani representative becomes ITSO Deputy Chairman

15.02.2013 12:01 GMT

W1siziisijiwmtuvmtavmtkvmtcvmtivmtevzgqwngnkntctmdhmni00zdk2ltg2yzity2i1mte1mtc4mgy3lzexmjq0ny5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=cfbec6fe97b2869c
Azerbaijani representative Mazahim Guliyev is appointed deputy chairman of the International Telecommunications Satellite Organization ITSO for Eastern Europe and North Africa.

Azerbaijan issues stamp on occasion of first satellite launch issued

15.02.2013 11:49 GMT

W1siziisijiwmtuvmtavmtkvmtcvmtivmdkvy2niytfjotytzjfhzs00nme3lwe4mgytmmrkndm2yjdlytfhlzexmjq0ns5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=105de7304a3855e3
Azermarka company of the Ministry of Communication and Information Technologies issued a postal stamp on occasion of the launch of the first telecommunication satellite of Azerbaijan Azerspace-1 into orbit.

Mobile communication now aboard AZAL airplanes

13.02.2013 18:30 GMT

W1siziisijiwmtuvmtavmtkvmtcvmtavndcvogmznjy0mzetmzgzmy00mza2lwexnzutnzuznzjhm2izmmi4lzexmjm0oc5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=3a461c0970badeaf
Azerbaijan mobile operator Azerfon (Nar Mobile) has introduced services of communication aboard four AZAL airliners.

Azerkosmos to get full control of the satellite in March

12.02.2013 15:06 GMT

W1siziisijiwmtuvmtavmtkvmtcvmdkvmzevmzzhmwjhzmetmje4nc00mdzjlweynjityzy2yzg4mjlmmji5lzexmji3nc5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=bd79d3944b249342
By 15 March, Azerkosmos will get the full control of the Azerbaijani satellite.

Azerbaijani satellite to take its orbital position from 15 February

12.02.2013 14:28 GMT

W1siziisijiwmtuvmtavmtkvmtcvmdkvmjyvzdqymzm2odqtzgqxyy00yzazlwfkmwutzmrjndrimtixyzuylzexmji2oc5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=4e1155a3d3bbb660
Azerbaijan's first telecommunications satellite Azerspace – 1 will take its position in the orbit, 45 degree east longitude, from 15 February.

Satellite launch ‘historical event for Azerbaijan

09.02.2013 14:17 GMT

W1siziisijiwmtuvmtavmtkvmtcvmdcvmdavytzizjq2mtgtmzqymi00zje1ltg3ogetnzu5owm1y2nmytbllzexmjezny5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=b3278fc82cfac036
The satellite launch is a historical event for Azerbaijan, this is an indicator of successful economic, political and social development.

Satellite launch ‘new page in Azerbaijani history'

09.02.2013 14:08 GMT

W1siziisijiwmtuvmtavmtkvmtcvmdyvntkvzwu5yznimzytmwy5mc00y2u3ltk5owetzdkxnzbjodg3otc3lzexmjezni5qcgcixsxbinailcj0ahvtyiisiji0mhgxodajil1d?sha=070e4b17a7b1cd70
Ireli public union has made a statement over the launch of the first telecommunication satellite into orbit on 8 February.

Top Read Articles

In The Region

Editor Picks

Azerbaijan Cuisine

Explore the food of Azerbaijan - from sherbet to succulent kebab, from baklava to fragrant pilaff

Follow us

Find us on Facebook

Real estate